Scaffold Ga0272433_10466725

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0272433_10466725

Scaffold Ga0272433_10466725

Overview

Basic Information
Taxon OID	3300031450 Open in IMG/M
Scaffold ID	Ga0272433_10466725 Open in IMG/M
Source Dataset Name	Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	529
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location
Location Name	Antarctica: Victoria Land
Coordinates	Lat. (^o)	-77.87	Long. (^o)	160.75	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034417	Metagenome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0272433_104667252	F034417	AGGAGG	MTWIISKPRDAWLQQAKEAWATLEPQAPQGAQLRALAVIDHHNFALLIEALAALTPGQVSQELQDVAGLRPVGDVLGMPDRGDTDGGDAAT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.