Scaffold Ga0272429_1002986

Overview

Basic Information

• Taxon OID: 3300031449
• Scaffold ID: Ga0272429_1002986
• Source Dataset Name: Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt sud
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 20241
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Victoria Land
• Coordinates
  • Lat. (^o): -77.7
  • Long. (^o): 160.75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087970	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0272429_10029863	F087970	N/A	MSILINLRDFKAMFVVNDDRAINSKIVFNEFNEKRTCRDENKLRALMIIFNITIINVTSIKLEFIKLINKSKCYAHEHSRNVSALMNVNAFMNVVNVSAFMNISQLNATKI