Scaffold Ga0308179_1007184

Overview

Basic Information

• Taxon OID: 3300031424
• Scaffold ID: Ga0308179_1007184
• Source Dataset Name: Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1008
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location

• Location Name: USA: Colorado
• Coordinates
  • Lat. (^o): 38.9206
  • Long. (^o): -106.9489
  • Depth (m): 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019107	Metagenome / Metatranscriptome	231	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0308179_10071842	F019107	GGA	MCIDCLEVFADDEEGTEDPTEPWVSIATDAVVKISGGLFQNLCEIAAAAEGAMEWKSDEIVVHSGMSAPVPLRFYVKKGDKVS