Scaffold Ga0307945_1185592

Overview

Basic Information

• Taxon OID: 3300031404
• Scaffold ID: Ga0307945_1185592
• Source Dataset Name: Saline water microbial communities from Organic Lake, Antarctica - #228
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 523
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Psychrobacter (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Organic Lake
• Coordinates
  • Lat. (^o): -68.4561
  • Long. (^o): 78.1899
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049335	Metagenome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307945_11855922	F049335	N/A	VQPRDRSVSIAASPAADGADPPDWSNTPAAIPDATSDTRTLSMLVWVRAVSANAAVKSPPLTLSKALAGKLVRLVQFCQARLKLVPADVSIRGKLVMLLQPRHAPRKPVPDDESISGKLVRLVHSCQA