Scaffold Ga0307506_10261172

Overview

Basic Information

• Taxon OID: 3300031366
• Scaffold ID: Ga0307506_10261172
• Source Dataset Name: Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 663
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location

• Location Name: USA: Washington
• Coordinates
  • Lat. (^o): 47.6684
  • Long. (^o): -121.924

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053494	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307506_102611721	F053494	N/A	VTRRSATLAILCLLGAANAVAADRAPIVAARGDAFVAHQNGSDVWSIGSENLELVIGFDASRTLTVQRLFNPVTGRALNITPAPAFGITAGGERITLSSSGAVAFVSGLAEATDHGVTLTFTFEHRAQRLLITRVLACYPGSPTIETWTRIASTGGDGTALTELVAWSLTMPLGNVRWLGGLRGDSANSDGASEEAFVFAEHDFEPGERLDLGSD