Basic Information | |
---|---|
Taxon OID | 3300031340 Open in IMG/M |
Scaffold ID | Ga0308146_1012244 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_322_32.3 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1400 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Western Arctic Ocean | |||||||
Coordinates | Lat. (o) | 80.9595 | Long. (o) | -132.1842 | Alt. (m) | Depth (m) | 86 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F090501 | Metagenome / Metatranscriptome | 108 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0308146_10122441 | F090501 | AGGAG | MIQDKQWWKSKTIWTAIVVCITSVAGEFGVEVPQSVFGVLGALGLYGVRDAVGKK |
⦗Top⦘ |