Scaffold Ga0255312_1028275

Overview

Basic Information

• Taxon OID: 3300031248
• Scaffold ID: Ga0255312_1028275
• Source Dataset Name: Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 1340
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Canada: Vancouver, British Columbia
• Coordinates
  • Lat. (^o): 49.2598372
  • Long. (^o): -123.2459363
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105284	Metagenome / Metatranscriptome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0255312_10282751	F105284	N/A	VQTAVSAQLTPRDWPIFGLTYATGDSERTWLTGDGRSRTVERQAFDSVAGSAYYAGRGFDVSGTSTYGYSRDPGRADREMTMLYHDLTLTLRPADSVAVMPSVSTGVDRYEWSATGYQTGSMSLLLTYTPTATRWSLWTLGAYTTSQSSDRTVDGRTMSVSGGLACGLGKILGGRASLSIEAGYDRYVDSVYPDASARGAFGLVLLKVASF