NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308395_1011736

Scaffold Ga0308395_1011736


Overview

Basic Information
Taxon OID3300031245 Open in IMG/M
Scaffold IDGa0308395_1011736 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3370
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (100.00%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Associated Families5

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002229Metagenome / Metatranscriptome580Y
F002372Metagenome / Metatranscriptome566Y
F002795Metagenome / Metatranscriptome529Y
F004024Metagenome / Metatranscriptome456N
F008135Metagenome / Metatranscriptome338Y

Sequences

Protein IDFamilyRBSSequence
Ga0308395_10117362F002372AGGGGGMPTRREDALWSVVHQRASHLRALLDGLDDVDISIAYELHYYPYAIVELLRVREDAPPLVLRSVYVQANRQWEYHSEFALRVVEAALQLVHEYRADPSLGGAEAVWA
Ga0308395_10117363F002795AGGAGGMATNDGLVLRGMIAAYREFISRKDGKTYRVVTVYGDLVAGEDVLCSVDGYDVFVDSSDYSRGEMVSFPARLQFARDGSGRPVIRLYVGEGVR
Ga0308395_10117364F008135AGGAGGMRAIDDFRTERLLISVGRDIARALDERQRHAIVLAVDVVWYIVAVLPPDEHMTCRDVVRLLRWFRKGLQEREEDDGDE
Ga0308395_10117365F002229GGAGGMVTLLTADGVEEVDYTPSDAEIRASLDDPGLYGMVLGVVTWMRLSSGAGWWTVLFGKRLVVTLAPAGWCWVMDGLGNRGYWSATLSAVVADVCAMYGGAVED
Ga0308395_10117367F004024AGGAMPSERDYLRQPSSLTDDDMMFLDARATLAAALSRAVVGYSDSRVRALAWLSIATPRLYDRIGPIIEASAIRQSPGASRTLRDALRALSLEEYMRRRDERRSDR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.