Scaffold Ga0265320_10013044

Overview

Basic Information

• Taxon OID: 3300031240
• Scaffold ID: Ga0265320_10013044
• Source Dataset Name: Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4796
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Carex Aquatilis Grown In University Of Washington, Seatle, Wa, United States

Source Dataset Sampling Location

• Location Name: USA: Seattle, Washington
• Coordinates
  • Lat. (^o): 47.6516
  • Long. (^o): -122.3045

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018046	Metagenome / Metatranscriptome	237	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0265320_100130446	F018046	GGAG	MPVVGTTAYNTAGQITALVRSLLNDAAGNLFTDAVLLPYVNSGYR