Scaffold Ga0265328_10174367

Overview

Basic Information

• Taxon OID: 3300031239
• Scaffold ID: Ga0265328_10174367
• Source Dataset Name: Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 813
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Carex Aquatilis Grown In University Of Washington, Seatle, Wa, United States

Source Dataset Sampling Location

• Location Name: USA: Seattle, Washington
• Coordinates
  • Lat. (^o): 47.6516
  • Long. (^o): -122.3045

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049762	Metagenome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265328_101743673	F049762	GAGG	VRTVLHLVRPGAGAPPGVVADRDWVVYVQPMALVRGGTPHTAPLPPGPLDHDQLVALVFAADLVVTW