Basic Information | |
---|---|
Taxon OID | 3300031209 Open in IMG/M |
Scaffold ID | Ga0307955_1049119 Open in IMG/M |
Source Dataset Name | Saline water microbial communities from Organic Lake, Antarctica - #439 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 790 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Antarctica: Organic Lake | |||||||
Coordinates | Lat. (o) | -68.4561 | Long. (o) | 78.1899 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034412 | Metagenome | 175 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307955_10491192 | F034412 | GAGG | VVIEEAGDVCGSKFGVSKIEDWLGCPLLVDGSVCVGGGPLIKLFVMGCLWCVAERGCGAGVV |
⦗Top⦘ |