NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307955_1037444

Scaffold Ga0307955_1037444


Overview

Basic Information
Taxon OID3300031209 Open in IMG/M
Scaffold IDGa0307955_1037444 Open in IMG/M
Source Dataset NameSaline water microbial communities from Organic Lake, Antarctica - #439
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)928
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Organic Lake
CoordinatesLat. (o)-68.4561Long. (o)78.1899Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008116Metagenome338Y

Sequences

Protein IDFamilyRBSSequence
Ga0307955_10374441F008116N/AFLLWWYANIIIMSDWGKGVNNNIGWGQGANNDIGWGSIYDKSNAGETLLSGGGIDPQAQAQITRIQNAGGTIEDTSVIDADIKFLKSIGLFANLKYAVDPRAGIMQRVDGSDIFASKIFDYSGSDADTANATGSAQPKKGILNGVTSLDFDGVDDKLTDEDTVTFLPGEEMFSIAVFAQDFTNSDVFGKVVDKFSPDSGGKNFGRSLDDIGVYGLDESFTPYQNVQILASGTSDTSNLQSGFISGSLIGTKTNAVNNVGKTLGRIRNINNVNRHAKAQFQKNWDFNALPTESQASAIYAYLQNQFNIT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.