Scaffold Ga0307931_1017288

Overview

Basic Information

• Taxon OID: 3300031208
• Scaffold ID: Ga0307931_1017288
• Source Dataset Name: Saline water microbial communities from Organic Lake, Antarctica - #47
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2558
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Organic Lake
• Coordinates
  • Lat. (^o): -68.457
  • Long. (^o): 78.1911
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042675	Metagenome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307931_10172881	F042675	N/A	NVLAERHAAVHFKATRLQARAVDAAPRIGASNVMKR