Scaffold Ga0307500_10064218

Overview

Basic Information

• Taxon OID: 3300031198
• Scaffold ID: Ga0307500_10064218
• Source Dataset Name: Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 917
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 45.6996
  • Long. (^o): -121.669

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046056	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307500_100642182	F046056	GGAGG	MDKAKISYAGVGAAVAGVIGILGIYSAWWETDFRTYNGTVDISGQLALAMSVGLFAFGGAYVLISDARIRRAMGALATLCAVVLTLACIWGLLRTDNVAPGATVSTGLFVSALGGVLGIAAGLLALRDSMAMEAAGSPDDQPSDVPIA