 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300031197 Open in IMG/M |
| Scaffold ID | Ga0255310_10000124 Open in IMG/M |
| Source Dataset Name | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Restricted |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 14600 |
| Total Scaffold Genes | 20 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 16 (80.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Vancouver, British Columbia | |||||||
| Coordinates | Lat. (o) | 49.2598372 | Long. (o) | -123.2459363 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001436 | Metagenome / Metatranscriptome | 695 | Y |
| F040185 | Metagenome | 162 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255310_1000012412 | F040185 | GGTGG | MSASMAQVELSPRSTHGRLPEWFARETEARSRSPLRREAVWHSRTRPVGNYGTTLAIHPRKRHRQFDDPEYRRARLTALASVVAAVAWTSFCITTAFVRLDSENFGKWRDWLITADEPVMPLSERLEAAIAALREVSRGVPTPVVVVADSIGAADSALPLSMKVTSYMPDTKIVLKGLAVGTTLTSGASGGDRDWRTSVEDLPYAYVIPPHGYVGVMTPVAELRDIDGHALTRTPMQFTWAAVDGSSTIEKKEPAENEPPVTAVASAADAGNQQLFGQFVEQKEKVVLPKPRPIKHASLGGKASKPKKQIATAHGYKERMPRRDLGADTRWASNELPPHSSFLEPDPRRDRRAIVDGIFRSLFYGGDANECGPATLKRGTQKKSGDDCDWSR |
| Ga0255310_100001246 | F001436 | GGA | MNTEKKDVATLIELLKMAAERWPHVETDHVLQSDLFHEDLSLLEMWPEACRRTGAGKREFPPAVIKLWKQRLGRTN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |