Scaffold Ga0255311_1025492

Overview

Basic Information

• Taxon OID: 3300031150
• Scaffold ID: Ga0255311_1025492
• Source Dataset Name: Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 1226
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Canada: Vancouver, British Columbia
• Coordinates
  • Lat. (^o): 49.2598372
  • Long. (^o): -123.2459363
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098821	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255311_10254921	F098821	AGGAG	VADEGRHCMDHGRTHLAYRWYVREKRSSEPEVFVIRGSAPRVDYLCNAAYSRLPEAEKAEWRLLE