Scaffold Ga0308022_1091215

Overview

Basic Information

• Taxon OID: 3300031142
• Scaffold ID: Ga0308022_1091215
• Source Dataset Name: Marine microbial communities from water near the shore, Antarctic Ocean - #353
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 915
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -68.5596
  • Long. (^o): 77.8957
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007003	Metagenome / Metatranscriptome	360	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308022_10912151	F007003	N/A	NGSNGKHLSGYYAWENFKDNWELNIIPTTKQEEFKKFYEHLDVETSDGIAWGVTGKKVIYMFVNDSKNPFILRSNIMPLAHELLHAVYQDGIGTHHITRKYDAPEGRAGTRGAAATVIVHDNWYGSKETIRFWIRHRFIWLPITIPYMPIKKAKEEYSI