NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308024_1001057

Scaffold Ga0308024_1001057


Overview

Basic Information
Taxon OID3300031140 Open in IMG/M
Scaffold IDGa0308024_1001057 Open in IMG/M
Source Dataset NameMarine microbial communities from water near the shore, Antarctic Ocean - #420
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10212
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (13.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5596Long. (o)77.8957Alt. (m)Depth (m)37
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037947Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0308024_10010574F037947N/AMKKIGLLGLLICMGMAAFASFPVESQMLLTEADPEKFKLDNLGFIIGILTCLLLPYSVLLLFIKKKNFRGSLAWGWLAGWVLILLIALLIFIGPEFMFLY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.