Scaffold Ga0308024_1000864

Overview

Basic Information

• Taxon OID: 3300031140
• Scaffold ID: Ga0308024_1000864
• Source Dataset Name: Marine microbial communities from water near the shore, Antarctic Ocean - #420
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11492
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (23.53%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -68.5596
  • Long. (^o): 77.8957
  • Depth (m): 37

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020607	Metagenome / Metatranscriptome	223	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308024_100086414	F020607	N/A	MNIEKLINDHPNNYSLGEAVRELYYEKRKLFSILSEKMKDCKIYDSPDGGHTIYVRGWGEEISTRKIQTNQLNLFDDLN