| Basic Information | |
|---|---|
| Taxon OID | 3300031122 Open in IMG/M |
| Scaffold ID | Ga0170822_16768461 Open in IMG/M |
| Source Dataset Name | Oak Spring Coassembly Site 11 - Champenoux / Amance forest |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 537 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | France: Champenoux | |||||||
| Coordinates | Lat. (o) | 48.7184 | Long. (o) | 6.3471 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082069 | Metagenome / Metatranscriptome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0170822_167684611 | F082069 | N/A | NTTRQHIVYTQLNPQTHSCRMSSLLEDGSVTHGPIHNCPGSLVGSPYFLGVGCHDVLVLWHGSRQIKLRRQEGWTVSRHHFESIVPHLPVLFDPFQRYYSLYEDSMIEIKDLNGDVLAQFFTDIQRATKFEFIDQHGTIWIANQTHMQSFRSTNDQAWLDF |
| ⦗Top⦘ |