Scaffold Ga0170822_15737845

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0170822_15737845

Scaffold Ga0170822_15737845

Overview

Basic Information
Taxon OID	3300031122 Open in IMG/M
Scaffold ID	Ga0170822_15737845 Open in IMG/M
Source Dataset Name	Oak Spring Coassembly Site 11 - Champenoux / Amance forest
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	603
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location Name	France: Champenoux
Coordinates	Lat. (^o)	48.7184	Long. (^o)	6.3471	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013548	Metagenome / Metatranscriptome	270	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170822_157378452	F013548	N/A	MISLFGKPEKVEPSFLEKLKASVTKTKAALSETVDNIFLGEKQIDPAALKHLETA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.