NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0170822_14479031

Scaffold Ga0170822_14479031


Overview

Basic Information
Taxon OID3300031122 Open in IMG/M
Scaffold IDGa0170822_14479031 Open in IMG/M
Source Dataset NameOak Spring Coassembly Site 11 - Champenoux / Amance forest
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)719
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameFrance: Champenoux
CoordinatesLat. (o)48.7184Long. (o)6.3471Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015697Metagenome / Metatranscriptome252Y

Sequences

Protein IDFamilyRBSSequence
Ga0170822_144790311F015697N/AVIYSSLIIAIVFFVGLTVQAVPSLSAEQLTKLKRNEAEGRIEPVTTSLIISAALPLVLNLFTGVLGNLFSKPNDIEERVVYGRPMQVKLCGAENCLQLLDKGSGLTAVGKGDTVQHALGDAAGAMLTLLLEKKLLSMHDLCREHIHFPHPDKESCPGVEINTCELSKPVLPQRKCMDSHGEAYCKKMKSHCSESLYEHFMMDNCYKTCTNNCEKPTPGPCDY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.