Scaffold Ga0061017_13881056

Overview

Basic Information

• Taxon OID: 3300031119
• Scaffold ID: Ga0061017_13881056
• Source Dataset Name: Coassembly of Cow X and Y Corn Stover
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1860
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis

Source Dataset Sampling Location

• Location Name: USA: Illinois
• Coordinates
  • Lat. (^o): 40.102108
  • Long. (^o): -88.227299

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076729	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0061017_138810562	F076729	AGGA	MNLTDTEVLKFLKGSPIFIEDICAVYSVTLGEIIDVGYEKF