Scaffold Ga0061012_12512541

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0061012_12512541

Scaffold Ga0061012_12512541

Overview

Basic Information
Taxon OID	3300031117 Open in IMG/M
Scaffold ID	Ga0061012_12512541 Open in IMG/M
Source Dataset Name	Coassembly of Cow X Rumen Fluid
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	564
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis

Source Dataset Sampling Location
Location Name	USA: Illinois
Coordinates	Lat. (^o)	40.102108	Long. (^o)	-88.227299	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021029	Metagenome / Metatranscriptome	220	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0061012_125125411	F021029	N/A	KMSENQSKDDMNFKEDEEGEEKPKIQTSLGGPGKFQPIKTRIRQLEKDLSDLRSGLNENKKAGMVIKGELAVLETTIKEKCNELCKCIMDDLANFDKDLKRVIQNDRTETDFFKVQTNSLNDDKIKLQKETISLQSRMRTCEIDIGVEPKS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.