Basic Information | |
---|---|
Taxon OID | 3300031116 Open in IMG/M |
Scaffold ID | Ga0318490_1419012 Open in IMG/M |
Source Dataset Name | Metatranscriptome of forest soil fungal communities from Los Alamos, New Mexico, United States - Jemez Pines Pi 5A (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 518 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Forest Soil Microbial Communities From France, Sweden And Usa, For Metatranscriptomics Studies |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: New Mexico | |||||||
Coordinates | Lat. (o) | 35.8911 | Long. (o) | -106.2978 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068325 | Metagenome / Metatranscriptome | 124 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0318490_14190121 | F068325 | N/A | LLFAVVYSQISCDINSDVACGDQNCCGCREQPNPQTGNGYLEYVSSCLNGGDGCIRNTGCRYCYRELGFLNNVGNRPLCARFLAPVEQLICQDDICCADKQHQNPLTGNGYLEFVASCLNGGDGCIGNTGCRLCYRPVSGGINIGNRNNCTRANLGL |
⦗Top⦘ |