Scaffold Ga0308187_10036086

Overview

Basic Information

• Taxon OID: 3300031114
• Scaffold ID: Ga0308187_10036086
• Source Dataset Name: Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1282
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location

• Location Name: USA: Colorado
• Coordinates
  • Lat. (^o): 38.9206
  • Long. (^o): -106.9489
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044740	Metagenome / Metatranscriptome	154	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0308187_100360862	F044740	GAGG	MPTSGYLSQSLRRPLPTKDDGILRTVADAAGYMMALSTDRQRAHWQRAARLLLDEAHAHDLSRQVELALFYDRQLDLRSSRLQSGESYTMHA