Scaffold Ga0272444_10004069

Overview

Basic Information

• Taxon OID: 3300031111
• Scaffold ID: Ga0272444_10004069
• Source Dataset Name: Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Form-13
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 12998
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (76.92%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment → Marine Sediment Archaeal Communities From Little Sippewissett Salt Marsh, Falmouth, Ma, United States

Source Dataset Sampling Location

• Location Name: USA: Falmouth, Massachusetts
• Coordinates
  • Lat. (^o): 41.5758
  • Long. (^o): -70.6394
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056961	Metagenome	137	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0272444_1000406913	F056961	GAGG	MNVEHRTSNVEHRIMYSTIYNKDKAKRLPHSTFDVERSMFDVQIVASEI