Scaffold Ga0315824_102330

Overview

Basic Information

• Taxon OID: 3300031109
• Scaffold ID: Ga0315824_102330
• Source Dataset Name: Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T12 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1150
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Plant Litter Microbial Communities From East Loma Ridge, Irvine, California

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.7417
  • Long. (^o): -117.7042
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042357	Metagenome / Metatranscriptome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315824_1023301	F042357	AGGAGG	VLGLASQREIPATLMDMKPKRTSLGRNPLSDAPHRNPGVVTNEQGPGRHPLGGAPYLDLDTVTSEQGSGRRSLNGALHRRPGVVKNKQGSSHLTRRVRRVRKLAEPKRIHIGS