Scaffold Ga0315828_119024

Overview

Basic Information

• Taxon OID: 3300031104
• Scaffold ID: Ga0315828_119024
• Source Dataset Name: Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T13 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 583
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Plant Litter Microbial Communities From East Loma Ridge, Irvine, California

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.7417
  • Long. (^o): -117.7042
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023769	Metagenome / Metatranscriptome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315828_1190241	F023769	N/A	AKGNTDELTMSPSVLHKNANQRSSSRVAHVTRSDDNPASGSSVNRCPTCRKTDRCTKETIHNGLLLLRLRYGLPYTELPDCNSGELSRFLSFLLLQGKERAPVTFPRSQRRGKDGLTTLVRLCRRDRWALAHGCSSIKRNLPKSCPLHTPSVRKNWESSALSQPPPLTPGYLEHVRRVCTRIFTSGWDRNYHSF