Scaffold Ga0061018_10574398

Overview

Basic Information

• Taxon OID: 3300031085
• Scaffold ID: Ga0061018_10574398
• Source Dataset Name: Coassembly of Cow X and Y Rumen Fluid
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 583
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis

Source Dataset Sampling Location

• Location Name: USA: Illinois
• Coordinates
  • Lat. (^o): 40.102108
  • Long. (^o): -88.227299

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086440	Metagenome / Metatranscriptome	110	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0061018_105743981	F086440	N/A	KKSQLKRQEPEPLNESYEGRYIREMNNEIEEGFHKKGEEIGMNEMCNNVIDNIIEGKEITELFNPPSQIKKGNRSMTFKLPKVSNNASVIKEEEKKQQNNGLFSEKFIKPHKKNYKNILILPLLNHKFKNNANVKFRQGETEKILAFEYYQNSYKQCVQINHSQEPLNSIRANYRLMWGNVNSFLKRK