| Basic Information | |
|---|---|
| Taxon OID | 3300031057 Open in IMG/M |
| Scaffold ID | Ga0170834_111169815 Open in IMG/M |
| Source Dataset Name | Oak Coassembly Site 11 - Champenoux / Amance forest |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 662 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | France: Champenoux | |||||||
| Coordinates | Lat. (o) | 48.7184 | Long. (o) | 6.3471 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030326 | Metagenome / Metatranscriptome | 185 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0170834_1111698151 | F030326 | GGCGG | MEIKSEDFSVGGVGEDNNAITTVRKTFNPVVDNDVVNQRLSNITSRAEVRVGESDVGWSLNAGDEVTLVGNESFLVCFGVNDVGGPVVFIEEFARSINSLLSSRFVIEPSDKVAFALSAPSVNQYGSGSSGRPHRLDLSRGISDQNAEESKRGRHSIFLLKKIFN |
| ⦗Top⦘ |