Scaffold Ga0170834_106724655

Overview

Basic Information

• Taxon OID: 3300031057
• Scaffold ID: Ga0170834_106724655
• Source Dataset Name: Oak Coassembly Site 11 - Champenoux / Amance forest
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5258
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: France: Champenoux
• Coordinates
  • Lat. (^o): 48.7184
  • Long. (^o): 6.3471

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002672	Metagenome / Metatranscriptome	538	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170834_1067246552	F002672	GGAGG	MQSIHARFVGVELYFDDLESAKKFYQETLGLSVSDEQLGHYAKFGGGGNFVCLERKGAESYPSKDKAVLFFDVPNLKSAIAAIGQDKFVQSESTWAVLHDPEGHNVLLLDRADAQRK