| Basic Information | |
|---|---|
| Taxon OID | 3300031056 Open in IMG/M |
| Scaffold ID | Ga0138346_10620535 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 578 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Atlantic ocean | |||||||
| Coordinates | Lat. (o) | -5.7 | Long. (o) | -26.0 | Alt. (m) | Depth (m) | 150 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002168 | Metatranscriptome | 587 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138346_106205351 | F002168 | N/A | FGGSRPQVLTRSAIELFVSSTMKSGVAFVFIIASLVSPASAGQASPIEKIIEMISDLQAKVIGEGADAQKAYDEYAEWCEDRSTKLGFEIKTGKASVAELTATIQEETSTIAALETKIEELSNDIKTDEADLDAATKIREKENADFKAEEKELLEVISMLERATSILSKEMAKSGASMLQLKSATSLTDALN |
| ⦗Top⦘ |