Scaffold Ga0073995_12012059

Overview

Basic Information

• Taxon OID: 3300031047
• Scaffold ID: Ga0073995_12012059
• Source Dataset Name: Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 555
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: USA: Montana
• Coordinates
  • Lat. (^o): 45.7544
  • Long. (^o): -113.9094

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090975	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073995_120120591	F090975	N/A	SPDCSPAPSKTNTSSGESPFLTTALRSGLPAFALGLAGTASATSAPGHDSLLIRHQMRGCHSWSANGGAFKASQSDTLRHGGWLTVTNNDVMPHTLVLTSGPSLRIAHPKLGHMGASLKITLTKPGVYHFTTKPGNDYMAGMKTIGDDNVLKLTVIVS