| Basic Information | |
|---|---|
| Taxon OID | 3300031034 Open in IMG/M |
| Scaffold ID | Ga0074041_10005513 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C1 (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 631 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta ricciae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Dalarna County | |||||||
| Coordinates | Lat. (o) | 60.97 | Long. (o) | 15.87 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017771 | Metagenome / Metatranscriptome | 238 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074041_100055131 | F017771 | N/A | ERVDFMWAQEEPAFFGYFKQLDTIYKAAIGGGERRRLVSHRPRVSLADYHARTVTTGSISLSSYGARTRRSWLVPADGSKSMRLQFTSFNTRRFSDFVRVFEVEDGHVGALIAVLHGSSLPNDIVLRPGVSALVTFSVHQMSAYRMSLVKGTGFELFVL |
| ⦗Top⦘ |