NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102765_11605969

Scaffold Ga0102765_11605969


Overview

Basic Information
Taxon OID3300031021 Open in IMG/M
Scaffold IDGa0102765_11605969 Open in IMG/M
Source Dataset NameForest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3A (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)574
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces litmocidini(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameNew Mexico, USA
CoordinatesLat. (o)35.8911Long. (o)-106.2978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078067Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0102765_116059691F078067N/AEVLDKRRVVFVSASFLSKQYKSISSDVLDNSVFFFGAKRSWLFPANREEMLEARTHKYLEFDEEFKSLILQKEANGLCCWQMPHNDFKKVSEFFEKIVDPVSGENYLPLILDDNWWLNEFDTKDAKFTSNLDQIMSNYKAGEHDYDAVMELIYQSNPTLVPTLYWASEAQEKI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.