Scaffold Ga0265732_105113

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0265732_105113

Scaffold Ga0265732_105113

Overview

Basic Information
Taxon OID	3300031016 Open in IMG/M
Scaffold ID	Ga0265732_105113 Open in IMG/M
Source Dataset Name	Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE4 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	514
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location Name	Norway: Oslo
Coordinates	Lat. (^o)	59.9992	Long. (^o)	10.7901	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009017	Metagenome / Metatranscriptome	324	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265732_1051131	F009017	N/A	NAVRLACLLHGFRFSGYRFNAFRRAAAFPILDRWLVTAFPSPATVLAFANPIPGSMVPACYFALSFAGFCARSAFRLRCRNWFAPIPAASTPQARCTSARNLIRPLSPSPLPSGNFRSLGIKAFNGRCCRTVRLPNSPDLRSLPAARFFYR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.