Scaffold Ga0073996_12456581

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073996_12456581

Scaffold Ga0073996_12456581

Overview

Basic Information
Taxon OID	3300030998 Open in IMG/M
Scaffold ID	Ga0073996_12456581 Open in IMG/M
Source Dataset Name	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1003
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location Name	USA: Montana
Coordinates	Lat. (^o)	45.7589	Long. (^o)	-113.9119	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046213	Metagenome / Metatranscriptome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073996_124565812	F046213	GAGG	LLLITQPVQMTLVSIGLEGKLIGAWVGETRQIVATASASNRVCLNLQGLTFADSRGIELLRTLRREGIPLLGCSPLIEGLLAANEVSANAIPSSTARASDDKDPKCP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.