Scaffold Ga0073994_10032978

Overview

Basic Information

• Taxon OID: 3300030991
• Scaffold ID: Ga0073994_10032978
• Source Dataset Name: Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1706
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: USA: Montana
• Coordinates
  • Lat. (^o): 45.7544
  • Long. (^o): -113.9094

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062122	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073994_100329781	F062122	AGG	MNLLFRSLSSLFPPRLPRFGFEDVSGTAEYYNRLARQDQVAMNPPGLWTGRISMQQVARVQPFKTAEKVPQMIPRRAA