Scaffold Ga0074027_11314111

Overview

Basic Information

• Taxon OID: 3300030980
• Scaffold ID: Ga0074027_11314111
• Source Dataset Name: Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 680
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Acalyptratae → Ephydroidea → Drosophilidae → Drosophilinae → Drosophilini → Drosophila → Sophophora → willistoni group → willistoni subgroup → Drosophila willistoni (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: Sweden: Dalarna County
• Coordinates
  • Lat. (^o): 60.97
  • Long. (^o): 15.87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045500	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074027_113141111	F045500	N/A	PSAPYDVLHPTHQFKGCIDPSEPFQCPQSERCIALQFICDGHPGDCPGNLDENEETCIAAKRPAKENIEKFLQAEYTLHGSKLFTFLFGHKLSKSIDENSPFWFDTLASAFSVAKTIRNFAEKTHMSSDDLAHFQNVIQMIHDGRLEEIPMFAQEAVNQGLASLIEKLYESGFMDQ