Scaffold Ga0075401_11524036

Overview

Basic Information

• Taxon OID: 3300030935
• Scaffold ID: Ga0075401_11524036
• Source Dataset Name: Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 540
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: France: Champenoux
• Coordinates
  • Lat. (^o): 48.7184
  • Long. (^o): 6.3471

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025326	Metagenome / Metatranscriptome	202	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075401_115240362	F025326	GGAGG	MSLTSQQKRGLFWALGILIMLTLSSVAWAQINTTLAHCFSLF