| Basic Information | |
|---|---|
| Taxon OID | 3300030923 Open in IMG/M |
| Scaffold ID | Ga0138296_1877071 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 750 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South-western Pyrenees, Aspurz, Spain | |||||||
| Coordinates | Lat. (o) | 42.0 | Long. (o) | 1.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015046 | Metagenome / Metatranscriptome | 257 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138296_18770711 | F015046 | N/A | AAAQQETGLNYLTKTMTGGIMCRAPLRRLEIWVPPKTPAGGKPILIQLHQNGKLISSQNVPFFAIGTTGKQGYAMTVIPGTDKSYTISMADGSGISPEWIIEFSDTIYGNRWSPDQIQLTVVGRTCPPITTSQHDRQFIWGDSNNNYLKVPGRGACTTFPDRPRTDCSKLPKIHLDEQCPQCSTVNCGDNAYCDCGTKKCYCKSGFSGANCQTDICDLAKCDPKSAACTMRYLGGDLAATLHQCVSSA |
| ⦗Top⦘ |