Scaffold Ga0073985_11034665

Overview

Basic Information

• Taxon OID: 3300030918
• Scaffold ID: Ga0073985_11034665
• Source Dataset Name: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_5 metaT (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 520
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic ocean
• Coordinates
  • Lat. (^o): -3.9
  • Long. (^o): -28.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078195	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073985_110346652	F078195	GGAGG	MASCKAIILLMTDSKVSAEKVEATCNKAAIGLDFPILANSAKAPSTEVGVMVLSFSTMTSRAAKTVGPYSYLLKKSA