| Basic Information | |
|---|---|
| Taxon OID | 3300030907 Open in IMG/M |
| Scaffold ID | Ga0074013_11101700 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFB (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 738 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Montana | |||||||
| Coordinates | Lat. (o) | 46.9233 | Long. (o) | -110.871944 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006133 | Metagenome / Metatranscriptome | 380 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074013_111017002 | F006133 | N/A | MSRLSRVALLVTLLVLVMSPFVYMVKSAGPERRAQDVEDCVACRYIWLQVEMDVGNSQIEENIYDSFTQNCIEAQKAPIFYPACQDMFDGIDDMIGDYMDGYTVNQVCENARLCR |
| ⦗Top⦘ |