| Basic Information | |
|---|---|
| Taxon OID | 3300030892 Open in IMG/M |
| Scaffold ID | Ga0315856_125939 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T23 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 578 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Plant Litter Microbial Communities From East Loma Ridge, Irvine, California |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 33.7417 | Long. (o) | -117.7042 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003289 | Metagenome / Metatranscriptome | 495 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315856_1259391 | F003289 | N/A | TEIALQSNFSIGFNNMKSDVLIHLTQXQYXXWFXFSFLWAFYYLVILRVIRFRTLKFRPRLATTLRPHGKXGDLIICIIPVSXCSNIITNSNLIMRMIEXQAETGLLTIRIRGKQXYXIYKFELKAFTDILTIPKNIGRDKXQISTPGDLQIADDYLHILQLRSQNKXVKKYWNDLNQKFSKQKNFHIISPQ |
| ⦗Top⦘ |