Scaffold Ga0265758_100747

Overview

Basic Information

• Taxon OID: 3300030884
• Scaffold ID: Ga0265758_100747
• Source Dataset Name: Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA5 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1167
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia tisae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Norway: Oslo
• Coordinates
  • Lat. (^o): 59.9989
  • Long. (^o): 10.7903

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026382	Metagenome / Metatranscriptome	198	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0265758_1007472	F026382	GGAGG	MPKTSIYVPDDLAELVRHYGLSVSEVAQAALREAVNESGRHFRRELAYVVLEHVKWREVVAGNYPDDPRNRQAAAALRALAEYILALEPDDSRLVHLRDSAEHARQLDSYVPETGEACGNWGRTLGSYGFYQDCTPEEGLRKLTEASDKDDAEWAALGGDVLAEVTRSVARSLGFADQDAIADADPEEAARIVRGRRRGTYMYKSA