Scaffold Ga0265770_1074025

Overview

Basic Information

• Taxon OID: 3300030878
• Scaffold ID: Ga0265770_1074025
• Source Dataset Name: Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 655
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Norway: Oslo
• Coordinates
  • Lat. (^o): 59.9979
  • Long. (^o): 10.7895

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037462	Metagenome / Metatranscriptome	168	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0265770_10740251	F037462	N/A	SKDKFFQQNHEKRFAHVRRSTQLGKKERRRADNSVYKIERAARDRADDQARRVPWQLLLETRNQYVEMQEFYFWARSVIETEASIPGWLAKMLDRRCAGFIEDQQQCEGDRSKTYPPPSVRLLFWSQEHMFGRAKNEGWFDAVQFYAIRDSRSTRAEVYWSECVKTWRKAKPRKYPSLKQWLSDAAGCDPFTHLTPGARKVKASYRLVEPKRLTEAV