Basic Information | |
---|---|
Taxon OID | 3300030873 Open in IMG/M |
Scaffold ID | Ga0265751_105750 Open in IMG/M |
Source Dataset Name | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 721 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Norway: Oslo | |||||||
Coordinates | Lat. (o) | 59.9982 | Long. (o) | 10.7894 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F060406 | Metagenome / Metatranscriptome | 133 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0265751_1057501 | F060406 | N/A | VSMLGELNSTTGCRVLRLPQRPTPSFRLRSRPLAAPARCFRLASTASHSGSTGGRLSRLGSAFCRSARSVANLRFASALRTAVRPLADLPACAGVLPQARPRTNFRLTSDLDPSARLVSNFRFAPVVVATSACAFCCCGLWLAPASARLPYPWRTSDSHRPVLPTGFTGFDSLGLRLASLLPAGLLMHP |
⦗Top⦘ |