Scaffold Ga0265723_1031190

Overview

Basic Information

• Taxon OID: 3300030872
• Scaffold ID: Ga0265723_1031190
• Source Dataset Name: Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 515
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Norway: Oslo
• Coordinates
  • Lat. (^o): 59.9989
  • Long. (^o): 10.7903

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096461	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265723_10311901	F096461	N/A	GLSVLLVMIVFGITSFGAAGLNGLYQGSPFFTNFFPSLTQLPLVLVGLGGIGVGTTPNGTIPGSIRPVYLSVARRRWLVALIVAVVGAAWALRLSGAIGNWPMTIILVVDLALLPVPAYVADYRARIAPPAFGLPERRSKEKRDAWFSEAASDEDPVRSGDPLPSLSGAGG