NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075377_11165325

Scaffold Ga0075377_11165325


Overview

Basic Information
Taxon OID3300030844 Open in IMG/M
Scaffold IDGa0075377_11165325 Open in IMG/M
Source Dataset NameForest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)535
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameFrance: Champenoux
CoordinatesLat. (o)48.7585Long. (o)6.3578Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097002Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0075377_111653251F097002N/ADARRTFQKESAGKRGQLMKFNPDTLASVHERMALIKAQSTGCFFTNYFREEMVGPQILTAATDRSVLLANDEHDFFRLYFFSTDLADLEQSLRDVDLPGNVVAGYLTKAADKTVDENVVAAFQQSGFDHIATYRRMITYQLPPQRPNPALEYAIAADVDQLHEALFQTFNKYAEHLP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.